Anti ST8SIA2 pAb (ATL-HPA054518)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054518-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ST8SIA2
Alternative Gene Name: HsT19690, SIAT8B, ST8SIA-II, STX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025789: 96%, ENSRNOG00000019128: 58%
Entrez Gene ID: 8128
Uniprot ID: Q92186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE |
Gene Sequence | SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE |
Gene ID - Mouse | ENSMUSG00000025789 |
Gene ID - Rat | ENSRNOG00000019128 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ST8SIA2 pAb (ATL-HPA054518) | |
Datasheet | Anti ST8SIA2 pAb (ATL-HPA054518) Datasheet (External Link) |
Vendor Page | Anti ST8SIA2 pAb (ATL-HPA054518) at Atlas Antibodies |
Documents & Links for Anti ST8SIA2 pAb (ATL-HPA054518) | |
Datasheet | Anti ST8SIA2 pAb (ATL-HPA054518) Datasheet (External Link) |
Vendor Page | Anti ST8SIA2 pAb (ATL-HPA054518) |