Anti ST7L pAb (ATL-HPA075418)

Atlas Antibodies

Catalog No.:
ATL-HPA075418-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: suppression of tumorigenicity 7 like
Gene Name: ST7L
Alternative Gene Name: FAM4B, FLJ20284, ST7R, STLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024353: 29%, ENSRNOG00000022009: 29%
Entrez Gene ID: 54879
Uniprot ID: Q8TDW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQFPEIMGIFAKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG
Gene Sequence HQFPEIMGIFAKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG
Gene ID - Mouse ENSMUSG00000024353
Gene ID - Rat ENSRNOG00000022009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST7L pAb (ATL-HPA075418)
Datasheet Anti ST7L pAb (ATL-HPA075418) Datasheet (External Link)
Vendor Page Anti ST7L pAb (ATL-HPA075418) at Atlas Antibodies

Documents & Links for Anti ST7L pAb (ATL-HPA075418)
Datasheet Anti ST7L pAb (ATL-HPA075418) Datasheet (External Link)
Vendor Page Anti ST7L pAb (ATL-HPA075418)