Anti ST7L pAb (ATL-HPA075418)

Atlas Antibodies

Catalog No.: ATL-HPA075418-25

Protein Description: suppression of tumorigenicity 7 like
Gene Name: ST7L
Alternative Gene Name: FAM4B, FLJ20284, ST7R, STLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024353: 29%, ENSRNOG00000022009: 29%
Entrez Gene ID: 54879
Uniprot ID: Q8TDW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQFPEIMGIFAKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG
• Gene Sequence: HQFPEIMGIFAKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG
• Gene ID - Mouse: ENSMUSG00000024353
• Gene ID - Rat: ENSRNOG00000022009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.