Anti ST6GALNAC3 pAb (ATL-HPA055399)

Atlas Antibodies

Catalog No.:
ATL-HPA055399-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
Gene Name: ST6GALNAC3
Alternative Gene Name: SIAT7C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052544: 76%, ENSRNOG00000056894: 78%
Entrez Gene ID: 256435
Uniprot ID: Q8NDV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDL
Gene Sequence EVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDL
Gene ID - Mouse ENSMUSG00000052544
Gene ID - Rat ENSRNOG00000056894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST6GALNAC3 pAb (ATL-HPA055399)
Datasheet Anti ST6GALNAC3 pAb (ATL-HPA055399) Datasheet (External Link)
Vendor Page Anti ST6GALNAC3 pAb (ATL-HPA055399) at Atlas Antibodies

Documents & Links for Anti ST6GALNAC3 pAb (ATL-HPA055399)
Datasheet Anti ST6GALNAC3 pAb (ATL-HPA055399) Datasheet (External Link)
Vendor Page Anti ST6GALNAC3 pAb (ATL-HPA055399)