Anti ST3GAL6 pAb (ATL-HPA018792)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018792-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ST3GAL6
Alternative Gene Name: SIAT10, ST3GALVI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022747: 71%, ENSRNOG00000001653: 75%
Entrez Gene ID: 10402
Uniprot ID: Q9Y274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNG |
| Gene Sequence | IQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNG |
| Gene ID - Mouse | ENSMUSG00000022747 |
| Gene ID - Rat | ENSRNOG00000001653 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ST3GAL6 pAb (ATL-HPA018792) | |
| Datasheet | Anti ST3GAL6 pAb (ATL-HPA018792) Datasheet (External Link) |
| Vendor Page | Anti ST3GAL6 pAb (ATL-HPA018792) at Atlas Antibodies |
| Documents & Links for Anti ST3GAL6 pAb (ATL-HPA018792) | |
| Datasheet | Anti ST3GAL6 pAb (ATL-HPA018792) Datasheet (External Link) |
| Vendor Page | Anti ST3GAL6 pAb (ATL-HPA018792) |