Anti ST3GAL4 pAb (ATL-HPA049827)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049827-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ST3GAL4
Alternative Gene Name: CGS23, FLJ11867, NANTA3, SAT3, SIAT4, SIAT4C, STZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032038: 82%, ENSRNOG00000009850: 82%
Entrez Gene ID: 6484
Uniprot ID: Q11206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYE |
| Gene Sequence | SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYE |
| Gene ID - Mouse | ENSMUSG00000032038 |
| Gene ID - Rat | ENSRNOG00000009850 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ST3GAL4 pAb (ATL-HPA049827) | |
| Datasheet | Anti ST3GAL4 pAb (ATL-HPA049827) Datasheet (External Link) |
| Vendor Page | Anti ST3GAL4 pAb (ATL-HPA049827) at Atlas Antibodies |
| Documents & Links for Anti ST3GAL4 pAb (ATL-HPA049827) | |
| Datasheet | Anti ST3GAL4 pAb (ATL-HPA049827) Datasheet (External Link) |
| Vendor Page | Anti ST3GAL4 pAb (ATL-HPA049827) |