Anti ST14 pAb (ATL-HPA047014)

Atlas Antibodies

Catalog No.:
ATL-HPA047014-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: suppression of tumorigenicity 14 (colon carcinoma)
Gene Name: ST14
Alternative Gene Name: HAI, MT-SP1, PRSS14, SNC19, TMPRSS14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031995: 82%, ENSRNOG00000005903: 82%
Entrez Gene ID: 6768
Uniprot ID: Q9Y5Y6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
Gene Sequence VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
Gene ID - Mouse ENSMUSG00000031995
Gene ID - Rat ENSRNOG00000005903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST14 pAb (ATL-HPA047014)
Datasheet Anti ST14 pAb (ATL-HPA047014) Datasheet (External Link)
Vendor Page Anti ST14 pAb (ATL-HPA047014) at Atlas Antibodies

Documents & Links for Anti ST14 pAb (ATL-HPA047014)
Datasheet Anti ST14 pAb (ATL-HPA047014) Datasheet (External Link)
Vendor Page Anti ST14 pAb (ATL-HPA047014)