Anti SSU72 pAb (ATL-HPA069290 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA069290-25

• 

Protein Description: SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae)
Gene Name: SSU72
Alternative Gene Name: HSPC182
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029038: 98%, ENSRNOG00000017829: 100%
Entrez Gene ID: 29101
Uniprot ID: Q9NP77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEER
• Gene Sequence: YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEER
• Gene ID - Mouse: ENSMUSG00000029038
• Gene ID - Rat: ENSRNOG00000017829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.