Anti SSTR4 pAb (ATL-HPA064252)

Atlas Antibodies

Catalog No.:
ATL-HPA064252-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: somatostatin receptor 4
Gene Name: SSTR4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037014: 76%, ENSRNOG00000004641: 74%
Entrez Gene ID: 6754
Uniprot ID: P31391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF
Gene Sequence YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF
Gene ID - Mouse ENSMUSG00000037014
Gene ID - Rat ENSRNOG00000004641
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SSTR4 pAb (ATL-HPA064252)
Datasheet Anti SSTR4 pAb (ATL-HPA064252) Datasheet (External Link)
Vendor Page Anti SSTR4 pAb (ATL-HPA064252) at Atlas Antibodies

Documents & Links for Anti SSTR4 pAb (ATL-HPA064252)
Datasheet Anti SSTR4 pAb (ATL-HPA064252) Datasheet (External Link)
Vendor Page Anti SSTR4 pAb (ATL-HPA064252)