Anti SSTR4 pAb (ATL-HPA064252)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064252-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SSTR4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037014: 76%, ENSRNOG00000004641: 74%
Entrez Gene ID: 6754
Uniprot ID: P31391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF |
Gene Sequence | YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF |
Gene ID - Mouse | ENSMUSG00000037014 |
Gene ID - Rat | ENSRNOG00000004641 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SSTR4 pAb (ATL-HPA064252) | |
Datasheet | Anti SSTR4 pAb (ATL-HPA064252) Datasheet (External Link) |
Vendor Page | Anti SSTR4 pAb (ATL-HPA064252) at Atlas Antibodies |
Documents & Links for Anti SSTR4 pAb (ATL-HPA064252) | |
Datasheet | Anti SSTR4 pAb (ATL-HPA064252) Datasheet (External Link) |
Vendor Page | Anti SSTR4 pAb (ATL-HPA064252) |