Anti SSR3 pAb (ATL-HPA014906)

Atlas Antibodies

Catalog No.: ATL-HPA014906-25

Protein Description: signal sequence receptor, gamma (translocon-associated protein gamma)
Gene Name: SSR3
Alternative Gene Name: TRAPG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027828: 100%, ENSRNOG00000018977: 35%
Entrez Gene ID: 6747
Uniprot ID: Q9UNL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
• Gene Sequence: VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
• Gene ID - Mouse: ENSMUSG00000027828
• Gene ID - Rat: ENSRNOG00000018977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SSR3 pAb (ATL-HPA014906) – 1 Found

Phoomak, Chatchai; Cui, Wei; Hayman, Thomas J; Yu, Seok-Ho; Zhao, Peng; Wells, Lance; Steet, Richard; Contessa, Joseph N. The translocon-associated protein (TRAP) complex regulates quality control of N-linked glycosylation during ER stress. Science Advances. 2021;7(3)