Anti SSH3 pAb (ATL-HPA019957)

Atlas Antibodies

Catalog No.:
ATL-HPA019957-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: slingshot protein phosphatase 3
Gene Name: SSH3
Alternative Gene Name: FLJ10928, FLJ20515
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034616: 75%, ENSRNOG00000018878: 76%
Entrez Gene ID: 54961
Uniprot ID: Q8TE77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEASSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAPRPPRLRY
Gene Sequence AVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEASSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAPRPPRLRY
Gene ID - Mouse ENSMUSG00000034616
Gene ID - Rat ENSRNOG00000018878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SSH3 pAb (ATL-HPA019957)
Datasheet Anti SSH3 pAb (ATL-HPA019957) Datasheet (External Link)
Vendor Page Anti SSH3 pAb (ATL-HPA019957) at Atlas Antibodies

Documents & Links for Anti SSH3 pAb (ATL-HPA019957)
Datasheet Anti SSH3 pAb (ATL-HPA019957) Datasheet (External Link)
Vendor Page Anti SSH3 pAb (ATL-HPA019957)