Anti SSH3 pAb (ATL-HPA019957)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019957-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SSH3
Alternative Gene Name: FLJ10928, FLJ20515
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034616: 75%, ENSRNOG00000018878: 76%
Entrez Gene ID: 54961
Uniprot ID: Q8TE77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEASSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAPRPPRLRY |
| Gene Sequence | AVQRRSRLQRRQSFAVLRGAVLGLQDGGDNDDAAEASSEPTEKAPSEEELHGDQTDFGQGSQSPQKQEEQRQHLHLMVQLLRPQDDIRLAAQLEAPRPPRLRY |
| Gene ID - Mouse | ENSMUSG00000034616 |
| Gene ID - Rat | ENSRNOG00000018878 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SSH3 pAb (ATL-HPA019957) | |
| Datasheet | Anti SSH3 pAb (ATL-HPA019957) Datasheet (External Link) |
| Vendor Page | Anti SSH3 pAb (ATL-HPA019957) at Atlas Antibodies |
| Documents & Links for Anti SSH3 pAb (ATL-HPA019957) | |
| Datasheet | Anti SSH3 pAb (ATL-HPA019957) Datasheet (External Link) |
| Vendor Page | Anti SSH3 pAb (ATL-HPA019957) |