Anti SSH2 pAb (ATL-HPA057099)

Atlas Antibodies

Catalog No.:
ATL-HPA057099-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: slingshot protein phosphatase 2
Gene Name: SSH2
Alternative Gene Name: KIAA1725
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037926: 65%, ENSRNOG00000014285: 67%
Entrez Gene ID: 85464
Uniprot ID: Q76I76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVEIIEYTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPE
Gene Sequence RVEIIEYTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPE
Gene ID - Mouse ENSMUSG00000037926
Gene ID - Rat ENSRNOG00000014285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SSH2 pAb (ATL-HPA057099)
Datasheet Anti SSH2 pAb (ATL-HPA057099) Datasheet (External Link)
Vendor Page Anti SSH2 pAb (ATL-HPA057099) at Atlas Antibodies

Documents & Links for Anti SSH2 pAb (ATL-HPA057099)
Datasheet Anti SSH2 pAb (ATL-HPA057099) Datasheet (External Link)
Vendor Page Anti SSH2 pAb (ATL-HPA057099)