Anti SSBP2 pAb (ATL-HPA071780)

Atlas Antibodies

SKU: ATL-HPA071780-25

• 
• 

Protein Description: single stranded DNA binding protein 2
Gene Name: SSBP2
Alternative Gene Name: HSPC116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061887: 100%, ENSRNOG00000007920: 100%
Entrez Gene ID: 23635
Uniprot ID: P81877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERR
• Gene Sequence: KLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERR
• Gene ID - Mouse: ENSMUSG00000061887
• Gene ID - Rat: ENSRNOG00000007920
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.