Anti SSBP2 pAb (ATL-HPA071780)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071780-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SSBP2
Alternative Gene Name: HSPC116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061887: 100%, ENSRNOG00000007920: 100%
Entrez Gene ID: 23635
Uniprot ID: P81877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERR |
Gene Sequence | KLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERR |
Gene ID - Mouse | ENSMUSG00000061887 |
Gene ID - Rat | ENSRNOG00000007920 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SSBP2 pAb (ATL-HPA071780) | |
Datasheet | Anti SSBP2 pAb (ATL-HPA071780) Datasheet (External Link) |
Vendor Page | Anti SSBP2 pAb (ATL-HPA071780) at Atlas Antibodies |
Documents & Links for Anti SSBP2 pAb (ATL-HPA071780) | |
Datasheet | Anti SSBP2 pAb (ATL-HPA071780) Datasheet (External Link) |
Vendor Page | Anti SSBP2 pAb (ATL-HPA071780) |