Anti SSBP2 pAb (ATL-HPA071780)

Atlas Antibodies

Catalog No.:
ATL-HPA071780-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: single stranded DNA binding protein 2
Gene Name: SSBP2
Alternative Gene Name: HSPC116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061887: 100%, ENSRNOG00000007920: 100%
Entrez Gene ID: 23635
Uniprot ID: P81877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERR
Gene Sequence KLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERR
Gene ID - Mouse ENSMUSG00000061887
Gene ID - Rat ENSRNOG00000007920
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SSBP2 pAb (ATL-HPA071780)
Datasheet Anti SSBP2 pAb (ATL-HPA071780) Datasheet (External Link)
Vendor Page Anti SSBP2 pAb (ATL-HPA071780) at Atlas Antibodies

Documents & Links for Anti SSBP2 pAb (ATL-HPA071780)
Datasheet Anti SSBP2 pAb (ATL-HPA071780) Datasheet (External Link)
Vendor Page Anti SSBP2 pAb (ATL-HPA071780)