Anti SSBP2 pAb (ATL-HPA068605)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068605-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SSBP2
Alternative Gene Name: HSPC116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003992: 76%, ENSRNOG00000016213: 76%
Entrez Gene ID: 23635
Uniprot ID: P81877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGPQSDPWLSLQNYGGAMRPPLNALGGPGMPGMNMGPGGGR |
| Gene Sequence | LGPQSDPWLSLQNYGGAMRPPLNALGGPGMPGMNMGPGGGR |
| Gene ID - Mouse | ENSMUSG00000003992 |
| Gene ID - Rat | ENSRNOG00000016213 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SSBP2 pAb (ATL-HPA068605) | |
| Datasheet | Anti SSBP2 pAb (ATL-HPA068605) Datasheet (External Link) |
| Vendor Page | Anti SSBP2 pAb (ATL-HPA068605) at Atlas Antibodies |
| Documents & Links for Anti SSBP2 pAb (ATL-HPA068605) | |
| Datasheet | Anti SSBP2 pAb (ATL-HPA068605) Datasheet (External Link) |
| Vendor Page | Anti SSBP2 pAb (ATL-HPA068605) |