Anti SS18L2 pAb (ATL-HPA047377)

Atlas Antibodies

Catalog No.:
ATL-HPA047377-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: synovial sarcoma translocation gene on chromosome 18-like 2
Gene Name: SS18L2
Alternative Gene Name: KIAA-iso
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032526: 92%, ENSRNOG00000047853: 92%
Entrez Gene ID: 51188
Uniprot ID: Q9UHA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLH
Gene Sequence VAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLH
Gene ID - Mouse ENSMUSG00000032526
Gene ID - Rat ENSRNOG00000047853
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SS18L2 pAb (ATL-HPA047377)
Datasheet Anti SS18L2 pAb (ATL-HPA047377) Datasheet (External Link)
Vendor Page Anti SS18L2 pAb (ATL-HPA047377) at Atlas Antibodies

Documents & Links for Anti SS18L2 pAb (ATL-HPA047377)
Datasheet Anti SS18L2 pAb (ATL-HPA047377) Datasheet (External Link)
Vendor Page Anti SS18L2 pAb (ATL-HPA047377)