Anti SS18 pAb (ATL-HPA059539)

Atlas Antibodies

Catalog No.:
ATL-HPA059539-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: synovial sarcoma translocation, chromosome 18
Gene Name: SS18
Alternative Gene Name: SSXT, SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037013: 96%, ENSRNOG00000016800: 96%
Entrez Gene ID: 6760
Uniprot ID: Q15532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMP
Gene Sequence NGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMP
Gene ID - Mouse ENSMUSG00000037013
Gene ID - Rat ENSRNOG00000016800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SS18 pAb (ATL-HPA059539)
Datasheet Anti SS18 pAb (ATL-HPA059539) Datasheet (External Link)
Vendor Page Anti SS18 pAb (ATL-HPA059539) at Atlas Antibodies

Documents & Links for Anti SS18 pAb (ATL-HPA059539)
Datasheet Anti SS18 pAb (ATL-HPA059539) Datasheet (External Link)
Vendor Page Anti SS18 pAb (ATL-HPA059539)