Anti SRSF6 pAb (ATL-HPA029005)

Atlas Antibodies

Catalog No.: ATL-HPA029005-100

Protein Description: serine/arginine-rich splicing factor 6
Gene Name: SRSF6
Alternative Gene Name: B52, SFRS6, SRP55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016921: 89%, ENSRNOG00000006380: 89%
Entrez Gene ID: 6431
Uniprot ID: Q13247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSR
• Gene Sequence: KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSR
• Gene ID - Mouse: ENSMUSG00000016921
• Gene ID - Rat: ENSRNOG00000006380
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SRSF6 pAb (ATL-HPA029005) – 1 Found

Park, Won Cheol; Kim, Hak-Ryul; Kang, Dong Baek; Ryu, Jae-Suk; Choi, Keum-Ha; Lee, Gyeong-Ok; Yun, Ki Jung; Kim, Keun Young; Park, Raekil; Yoon, Kwon-Ha; Cho, Ji-Hyun; Lee, Young-Jin; Chae, Soo-Cheon; Park, Min-Cheol; Park, Do-Sim. Comparative expression patterns and diagnostic efficacies of SR splicing factors and HNRNPA1 in gastric and colorectal cancer. Bmc Cancer. 2016;16( 27282379):358.