Anti SRSF2 pAb (ATL-HPA049905)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049905-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: SRSF2
Alternative Gene Name: PR264, SC-35, SC35, SFRS2, SFRS2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034120: 97%, ENSRNOG00000000248: 97%
Entrez Gene ID: 6427
Uniprot ID: Q01130
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR |
| Gene Sequence | LKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPR |
| Gene ID - Mouse | ENSMUSG00000034120 |
| Gene ID - Rat | ENSRNOG00000000248 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRSF2 pAb (ATL-HPA049905) | |
| Datasheet | Anti SRSF2 pAb (ATL-HPA049905) Datasheet (External Link) |
| Vendor Page | Anti SRSF2 pAb (ATL-HPA049905) at Atlas Antibodies |
| Documents & Links for Anti SRSF2 pAb (ATL-HPA049905) | |
| Datasheet | Anti SRSF2 pAb (ATL-HPA049905) Datasheet (External Link) |
| Vendor Page | Anti SRSF2 pAb (ATL-HPA049905) |
| Citations for Anti SRSF2 pAb (ATL-HPA049905) – 2 Found |
| Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. PubMed |
| Guantes, Raul; Rastrojo, Alberto; Neves, Ricardo; Lima, Ana; Aguado, Begoña; Iborra, Francisco J. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Research. 2015;25(5):633-44. PubMed |