Anti SRSF10 pAb (ATL-HPA053831)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053831-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SRSF10
Alternative Gene Name: FUSIP1, FUSIP2, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR1, TASR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028676: 100%, ENSRNOG00000010007: 41%
Entrez Gene ID: 10772
Uniprot ID: O75494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS |
Gene Sequence | QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS |
Gene ID - Mouse | ENSMUSG00000028676 |
Gene ID - Rat | ENSRNOG00000010007 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SRSF10 pAb (ATL-HPA053831) | |
Datasheet | Anti SRSF10 pAb (ATL-HPA053831) Datasheet (External Link) |
Vendor Page | Anti SRSF10 pAb (ATL-HPA053831) at Atlas Antibodies |
Documents & Links for Anti SRSF10 pAb (ATL-HPA053831) | |
Datasheet | Anti SRSF10 pAb (ATL-HPA053831) Datasheet (External Link) |
Vendor Page | Anti SRSF10 pAb (ATL-HPA053831) |
Citations for Anti SRSF10 pAb (ATL-HPA053831) – 2 Found |
Bhatta, Bibek; Luz, Ishai; Krueger, Christian; Teo, Fanny Xueting; Lane, David P; Sabapathy, Kanaga; Cooks, Tomer. Cancer Cells Shuttle Extracellular Vesicles Containing Oncogenic Mutant p53 Proteins to the Tumor Microenvironment. Cancers. 2021;13(12) PubMed |
Yadav, Sandhya; Pant, Deepak; Samaiya, Atul; Kalra, Neetu; Gupta, Sanjay; Shukla, Sanjeev. ERK1/2-EGR1-SRSF10 Axis Mediated Alternative Splicing Plays a Critical Role in Head and Neck Cancer. Frontiers In Cell And Developmental Biology. 9( 34616729):713661. PubMed |