Anti SRRT pAb (ATL-HPA058379)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058379-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: SRRT
Alternative Gene Name: ARS2, Asr2, serrate
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037364: 100%, ENSRNOG00000048277: 92%
Entrez Gene ID: 51593
Uniprot ID: Q9BXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF |
Gene Sequence | GLTPGLPYPHQTPQGLMPYGQPRPPILGYGAGAVRPAVPTGGPPYPHAPYGAGRGNYDAFRGQGGYPGKPRNRMVRGDPRAIVEYRDLDAPDDVDFF |
Gene ID - Mouse | ENSMUSG00000037364 |
Gene ID - Rat | ENSRNOG00000048277 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SRRT pAb (ATL-HPA058379) | |
Datasheet | Anti SRRT pAb (ATL-HPA058379) Datasheet (External Link) |
Vendor Page | Anti SRRT pAb (ATL-HPA058379) at Atlas Antibodies |
Documents & Links for Anti SRRT pAb (ATL-HPA058379) | |
Datasheet | Anti SRRT pAb (ATL-HPA058379) Datasheet (External Link) |
Vendor Page | Anti SRRT pAb (ATL-HPA058379) |