Anti SRRT pAb (ATL-HPA042858 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042858-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: serrate, RNA effector molecule
Gene Name: SRRT
Alternative Gene Name: ARS2, Asr2, serrate
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037364: 100%, ENSRNOG00000048277: 43%
Entrez Gene ID: 51593
Uniprot ID: Q9BXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQI
Gene Sequence TCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQI
Gene ID - Mouse ENSMUSG00000037364
Gene ID - Rat ENSRNOG00000048277
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SRRT pAb (ATL-HPA042858 w/enhanced validation)
Datasheet Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SRRT pAb (ATL-HPA042858 w/enhanced validation)
Datasheet Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SRRT pAb (ATL-HPA042858 w/enhanced validation)
Citations for Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) – 1 Found
Mesa-Perez, Monica; Hamilton, Phineas T; Miranda, Alex; Brodie, Nicholas; O'Sullivan, Connor; Christie, Jennifer; Ryan, Bridget C; Chow, Robert L; Goodlett, David; Nelson, Christopher J; Howard, Perry L. Cytoplasmic switch of ARS2 isoforms promotes nonsense-mediated mRNA decay and arsenic sensitivity. Nucleic Acids Research. 2022;50(3):1620-1638.  PubMed