Anti SRRT pAb (ATL-HPA042858 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042858-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SRRT
Alternative Gene Name: ARS2, Asr2, serrate
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037364: 100%, ENSRNOG00000048277: 43%
Entrez Gene ID: 51593
Uniprot ID: Q9BXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQI |
| Gene Sequence | TCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQI |
| Gene ID - Mouse | ENSMUSG00000037364 |
| Gene ID - Rat | ENSRNOG00000048277 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) | |
| Datasheet | Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) | |
| Datasheet | Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) |
| Citations for Anti SRRT pAb (ATL-HPA042858 w/enhanced validation) – 1 Found |
| Mesa-Perez, Monica; Hamilton, Phineas T; Miranda, Alex; Brodie, Nicholas; O'Sullivan, Connor; Christie, Jennifer; Ryan, Bridget C; Chow, Robert L; Goodlett, David; Nelson, Christopher J; Howard, Perry L. Cytoplasmic switch of ARS2 isoforms promotes nonsense-mediated mRNA decay and arsenic sensitivity. Nucleic Acids Research. 2022;50(3):1620-1638. PubMed |