Anti SRRM1 pAb (ATL-HPA058612 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058612-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SRRM1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: serine/arginine repetitive matrix 1
Gene Name: SRRM1
Alternative Gene Name: MGC39488, POP101, SRM160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028809: 87%, ENSRNOG00000018194: 83%
Entrez Gene ID: 10250
Uniprot ID: Q8IYB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVS
Gene Sequence IAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVS
Gene ID - Mouse ENSMUSG00000028809
Gene ID - Rat ENSRNOG00000018194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SRRM1 pAb (ATL-HPA058612 w/enhanced validation)
Datasheet Anti SRRM1 pAb (ATL-HPA058612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SRRM1 pAb (ATL-HPA058612 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SRRM1 pAb (ATL-HPA058612 w/enhanced validation)
Datasheet Anti SRRM1 pAb (ATL-HPA058612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SRRM1 pAb (ATL-HPA058612 w/enhanced validation)