Anti SRP68 pAb (ATL-HPA055617)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055617-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SRP68
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020780: 94%, ENSRNOG00000009351: 93%
Entrez Gene ID: 6730
Uniprot ID: Q9UHB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AESEETKERLFESMLSECRDAIQVVREELKPDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELL |
Gene Sequence | AESEETKERLFESMLSECRDAIQVVREELKPDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELL |
Gene ID - Mouse | ENSMUSG00000020780 |
Gene ID - Rat | ENSRNOG00000009351 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SRP68 pAb (ATL-HPA055617) | |
Datasheet | Anti SRP68 pAb (ATL-HPA055617) Datasheet (External Link) |
Vendor Page | Anti SRP68 pAb (ATL-HPA055617) at Atlas Antibodies |
Documents & Links for Anti SRP68 pAb (ATL-HPA055617) | |
Datasheet | Anti SRP68 pAb (ATL-HPA055617) Datasheet (External Link) |
Vendor Page | Anti SRP68 pAb (ATL-HPA055617) |