Anti SRP68 pAb (ATL-HPA055617)

Atlas Antibodies

Catalog No.:
ATL-HPA055617-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: signal recognition particle 68kDa
Gene Name: SRP68
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020780: 94%, ENSRNOG00000009351: 93%
Entrez Gene ID: 6730
Uniprot ID: Q9UHB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AESEETKERLFESMLSECRDAIQVVREELKPDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELL
Gene Sequence AESEETKERLFESMLSECRDAIQVVREELKPDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKRSPRPQDLIRLYDIILQNLVELL
Gene ID - Mouse ENSMUSG00000020780
Gene ID - Rat ENSRNOG00000009351
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SRP68 pAb (ATL-HPA055617)
Datasheet Anti SRP68 pAb (ATL-HPA055617) Datasheet (External Link)
Vendor Page Anti SRP68 pAb (ATL-HPA055617) at Atlas Antibodies

Documents & Links for Anti SRP68 pAb (ATL-HPA055617)
Datasheet Anti SRP68 pAb (ATL-HPA055617) Datasheet (External Link)
Vendor Page Anti SRP68 pAb (ATL-HPA055617)