Anti SRP54 pAb (ATL-HPA062044)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062044-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SRP54
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079108: 99%, ENSRNOG00000032776: 99%
Entrez Gene ID: 6729
Uniprot ID: P61011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVT |
| Gene Sequence | VIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVT |
| Gene ID - Mouse | ENSMUSG00000079108 |
| Gene ID - Rat | ENSRNOG00000032776 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRP54 pAb (ATL-HPA062044) | |
| Datasheet | Anti SRP54 pAb (ATL-HPA062044) Datasheet (External Link) |
| Vendor Page | Anti SRP54 pAb (ATL-HPA062044) at Atlas Antibodies |
| Documents & Links for Anti SRP54 pAb (ATL-HPA062044) | |
| Datasheet | Anti SRP54 pAb (ATL-HPA062044) Datasheet (External Link) |
| Vendor Page | Anti SRP54 pAb (ATL-HPA062044) |