Anti SRP54 pAb (ATL-HPA048977)

Atlas Antibodies

Catalog No.:
ATL-HPA048977-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: signal recognition particle 54kDa
Gene Name: SRP54
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079108: 100%, ENSRNOG00000032776: 100%
Entrez Gene ID: 6729
Uniprot ID: P61011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNV
Gene Sequence SALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNV
Gene ID - Mouse ENSMUSG00000079108
Gene ID - Rat ENSRNOG00000032776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SRP54 pAb (ATL-HPA048977)
Datasheet Anti SRP54 pAb (ATL-HPA048977) Datasheet (External Link)
Vendor Page Anti SRP54 pAb (ATL-HPA048977) at Atlas Antibodies

Documents & Links for Anti SRP54 pAb (ATL-HPA048977)
Datasheet Anti SRP54 pAb (ATL-HPA048977) Datasheet (External Link)
Vendor Page Anti SRP54 pAb (ATL-HPA048977)