Anti SRI pAb (ATL-HPA019004 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019004-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: SRI
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003161: 100%, ENSRNOG00000049780: 95%
Entrez Gene ID: 6717
Uniprot ID: P30626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYK |
| Gene Sequence | GGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYK |
| Gene ID - Mouse | ENSMUSG00000003161 |
| Gene ID - Rat | ENSRNOG00000049780 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SRI pAb (ATL-HPA019004 w/enhanced validation) | |
| Datasheet | Anti SRI pAb (ATL-HPA019004 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SRI pAb (ATL-HPA019004 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SRI pAb (ATL-HPA019004 w/enhanced validation) | |
| Datasheet | Anti SRI pAb (ATL-HPA019004 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SRI pAb (ATL-HPA019004 w/enhanced validation) |