Anti SREK1 pAb (ATL-HPA037673)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037673-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SREK1
Alternative Gene Name: DKFZp564B176, SFRS12, SRrp508, SRrp86
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032621: 90%, ENSRNOG00000032735: 89%
Entrez Gene ID: 140890
Uniprot ID: Q8WXA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PAPTMTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLN |
| Gene Sequence | PAPTMTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLN |
| Gene ID - Mouse | ENSMUSG00000032621 |
| Gene ID - Rat | ENSRNOG00000032735 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SREK1 pAb (ATL-HPA037673) | |
| Datasheet | Anti SREK1 pAb (ATL-HPA037673) Datasheet (External Link) |
| Vendor Page | Anti SREK1 pAb (ATL-HPA037673) at Atlas Antibodies |
| Documents & Links for Anti SREK1 pAb (ATL-HPA037673) | |
| Datasheet | Anti SREK1 pAb (ATL-HPA037673) Datasheet (External Link) |
| Vendor Page | Anti SREK1 pAb (ATL-HPA037673) |