Anti SREK1 pAb (ATL-HPA037673)

Atlas Antibodies

Catalog No.:
ATL-HPA037673-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: splicing regulatory glutamine/lysine-rich protein 1
Gene Name: SREK1
Alternative Gene Name: DKFZp564B176, SFRS12, SRrp508, SRrp86
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032621: 90%, ENSRNOG00000032735: 89%
Entrez Gene ID: 140890
Uniprot ID: Q8WXA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAPTMTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLN
Gene Sequence PAPTMTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLN
Gene ID - Mouse ENSMUSG00000032621
Gene ID - Rat ENSRNOG00000032735
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SREK1 pAb (ATL-HPA037673)
Datasheet Anti SREK1 pAb (ATL-HPA037673) Datasheet (External Link)
Vendor Page Anti SREK1 pAb (ATL-HPA037673) at Atlas Antibodies

Documents & Links for Anti SREK1 pAb (ATL-HPA037673)
Datasheet Anti SREK1 pAb (ATL-HPA037673) Datasheet (External Link)
Vendor Page Anti SREK1 pAb (ATL-HPA037673)