Anti SREBF1 pAb (ATL-HPA043878)

Atlas Antibodies

Catalog No.:
ATL-HPA043878-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sterol regulatory element binding transcription factor 1
Gene Name: SREBF1
Alternative Gene Name: bHLHd1, SREBP-1c, SREBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020538: 86%, ENSRNOG00000003463: 84%
Entrez Gene ID: 6720
Uniprot ID: P36956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSM
Gene Sequence WESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSM
Gene ID - Mouse ENSMUSG00000020538
Gene ID - Rat ENSRNOG00000003463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SREBF1 pAb (ATL-HPA043878)
Datasheet Anti SREBF1 pAb (ATL-HPA043878) Datasheet (External Link)
Vendor Page Anti SREBF1 pAb (ATL-HPA043878) at Atlas Antibodies

Documents & Links for Anti SREBF1 pAb (ATL-HPA043878)
Datasheet Anti SREBF1 pAb (ATL-HPA043878) Datasheet (External Link)
Vendor Page Anti SREBF1 pAb (ATL-HPA043878)