Anti SRA1 pAb (ATL-HPA050153)

Atlas Antibodies

Catalog No.:
ATL-HPA050153-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: steroid receptor RNA activator 1
Gene Name: SRA1
Alternative Gene Name: SRA, STRAA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006050: 79%, ENSRNOG00000018089: 77%
Entrez Gene ID: 10011
Uniprot ID: Q9HD15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Gene Sequence RMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Gene ID - Mouse ENSMUSG00000006050
Gene ID - Rat ENSRNOG00000018089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SRA1 pAb (ATL-HPA050153)
Datasheet Anti SRA1 pAb (ATL-HPA050153) Datasheet (External Link)
Vendor Page Anti SRA1 pAb (ATL-HPA050153) at Atlas Antibodies

Documents & Links for Anti SRA1 pAb (ATL-HPA050153)
Datasheet Anti SRA1 pAb (ATL-HPA050153) Datasheet (External Link)
Vendor Page Anti SRA1 pAb (ATL-HPA050153)