Anti SQSTM1 pAb (ATL-HPA064165)

Atlas Antibodies

SKU:
ATL-HPA064165-100
  • Immunofluorescent staining of human cell line A549 shows localization to cytosol & vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Protein Description: sequestosome 1
Gene Name: SQSTM1
Alternative Gene Name: A170, OSIL, p60, p62, p62B, PDB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015837: 100%, ENSRNOG00000003147: 100%
Entrez Gene ID: 8878
Uniprot ID: Q13501
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Gene Sequence GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Gene ID - Mouse ENSMUSG00000015837
Gene ID - Rat ENSRNOG00000003147
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SQSTM1 pAb (ATL-HPA064165)
Datasheet Anti SQSTM1 pAb (ATL-HPA064165) Datasheet (External Link)
Vendor Page Anti SQSTM1 pAb (ATL-HPA064165) at Atlas Antibodies

Documents & Links for Anti SQSTM1 pAb (ATL-HPA064165)
Datasheet Anti SQSTM1 pAb (ATL-HPA064165) Datasheet (External Link)
Vendor Page Anti SQSTM1 pAb (ATL-HPA064165)