Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017079-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SQRDL
Alternative Gene Name: CGI-44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005803: 89%, ENSRNOG00000000172: 93%
Entrez Gene ID: 58472
Uniprot ID: Q9Y6N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWG |
| Gene Sequence | TSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWG |
| Gene ID - Mouse | ENSMUSG00000005803 |
| Gene ID - Rat | ENSRNOG00000000172 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation) | |
| Datasheet | Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation) | |
| Datasheet | Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation) |
| Citations for Anti SQRDL pAb (ATL-HPA017079 w/enhanced validation) – 4 Found |
| Malagrinò, Francesca; Zuhra, Karim; Mascolo, Ludovica; Mastronicola, Daniela; Vicente, João B; Forte, Elena; Giuffrè, Alessandro. Hydrogen Sulfide Oxidation: Adaptive Changes in Mitochondria of SW480 Colorectal Cancer Cells upon Exposure to Hypoxia. Oxidative Medicine And Cellular Longevity. 2019( 30838088):8102936. PubMed |
| Zuhra, Karim; Tomé, Catarina S; Masi, Letizia; Giardina, Giorgio; Paulini, Giulia; Malagrinò, Francesca; Forte, Elena; Vicente, João B; Giuffrè, Alessandro. N-Acetylcysteine Serves as Substrate of 3-Mercaptopyruvate Sulfurtransferase and Stimulates Sulfide Metabolism in Colon Cancer Cells. Cells. 2019;8(8) PubMed |
| Panagaki, Theodora; Lozano-Montes, Laura; Janickova, Lucia; Zuhra, Karim; Szabo, Marcell P; Majtan, Tomas; Rainer, Gregor; Maréchal, Damien; Herault, Yann; Szabo, Csaba. Overproduction of hydrogen sulfide, generated by cystathionine β-synthase, disrupts brain wave patterns and contributes to neurobehavioral dysfunction in a rat model of down syndrome. Redox Biology. 2022;51( 35042677):102233. PubMed |
| Zivanovic, Jasmina; Kouroussis, Emilia; Kohl, Joshua B; Adhikari, Bikash; Bursac, Biljana; Schott-Roux, Sonia; Petrovic, Dunja; Miljkovic, Jan Lj; Thomas-Lopez, Daniel; Jung, Youngeun; Miler, Marko; Mitchell, Sarah; Milosevic, Verica; Gomes, Jose Eduardo; Benhar, Moran; Gonzalez-Zorn, Bruno; Ivanovic-Burmazovic, Ivana; Torregrossa, Roberta; Mitchell, James R; Whiteman, Matthew; Schwarz, Guenter; Snyder, Solomon H; Paul, Bindu D; Carroll, Kate S; Filipovic, Milos R. Selective Persulfide Detection Reveals Evolutionarily Conserved Antiaging Effects of S-Sulfhydration. Cell Metabolism. 2019;30(6):1152-1170.e13. PubMed |