Anti SPTY2D1 pAb (ATL-HPA039372)

Atlas Antibodies

Catalog No.:
ATL-HPA039372-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SPT2, Suppressor of Ty, domain containing 1 (S. cerevisiae)
Gene Name: SPTY2D1
Alternative Gene Name: DKFZp686I068, FLJ39441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049516: 82%, ENSRNOG00000050806: 79%
Entrez Gene ID: 144108
Uniprot ID: Q68D10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLERKHRRKKLETDGKLPPTVSKKAPSQKESVGTK
Gene Sequence PPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLERKHRRKKLETDGKLPPTVSKKAPSQKESVGTK
Gene ID - Mouse ENSMUSG00000049516
Gene ID - Rat ENSRNOG00000050806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPTY2D1 pAb (ATL-HPA039372)
Datasheet Anti SPTY2D1 pAb (ATL-HPA039372) Datasheet (External Link)
Vendor Page Anti SPTY2D1 pAb (ATL-HPA039372) at Atlas Antibodies

Documents & Links for Anti SPTY2D1 pAb (ATL-HPA039372)
Datasheet Anti SPTY2D1 pAb (ATL-HPA039372) Datasheet (External Link)
Vendor Page Anti SPTY2D1 pAb (ATL-HPA039372)