Anti SPTY2D1 pAb (ATL-HPA039372)

Atlas Antibodies

Catalog No.: ATL-HPA039372-25

Protein Description: SPT2, Suppressor of Ty, domain containing 1 (S. cerevisiae)
Gene Name: SPTY2D1
Alternative Gene Name: DKFZp686I068, FLJ39441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049516: 82%, ENSRNOG00000050806: 79%
Entrez Gene ID: 144108
Uniprot ID: Q68D10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLERKHRRKKLETDGKLPPTVSKKAPSQKESVGTK
• Gene Sequence: PPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLERKHRRKKLETDGKLPPTVSKKAPSQKESVGTK
• Gene ID - Mouse: ENSMUSG00000049516
• Gene ID - Rat: ENSRNOG00000050806
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.