Anti SPTLC3 pAb (ATL-HPA048079)

Atlas Antibodies

SKU: ATL-HPA048079-25

• 
• 

Protein Description: serine palmitoyltransferase, long chain base subunit 3
Gene Name: SPTLC3
Alternative Gene Name: C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039092: 53%, ENSRNOG00000004443: 52%
Entrez Gene ID: 55304
Uniprot ID: Q9NUV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
• Gene Sequence: MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
• Gene ID - Mouse: ENSMUSG00000039092
• Gene ID - Rat: ENSRNOG00000004443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.