Anti SPTLC3 pAb (ATL-HPA048079)

Atlas Antibodies

Catalog No.:
ATL-HPA048079-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: serine palmitoyltransferase, long chain base subunit 3
Gene Name: SPTLC3
Alternative Gene Name: C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039092: 53%, ENSRNOG00000004443: 52%
Entrez Gene ID: 55304
Uniprot ID: Q9NUV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
Gene Sequence MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
Gene ID - Mouse ENSMUSG00000039092
Gene ID - Rat ENSRNOG00000004443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPTLC3 pAb (ATL-HPA048079)
Datasheet Anti SPTLC3 pAb (ATL-HPA048079) Datasheet (External Link)
Vendor Page Anti SPTLC3 pAb (ATL-HPA048079) at Atlas Antibodies

Documents & Links for Anti SPTLC3 pAb (ATL-HPA048079)
Datasheet Anti SPTLC3 pAb (ATL-HPA048079) Datasheet (External Link)
Vendor Page Anti SPTLC3 pAb (ATL-HPA048079)