Anti SPTLC1 pAb (ATL-HPA063907 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA063907-25

Protein Description: serine palmitoyltransferase, long chain base subunit 1
Gene Name: SPTLC1
Alternative Gene Name: hLCB1, HSAN1, HSN1, LCB1, SPTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021468: 88%, ENSRNOG00000010882: 86%
Entrez Gene ID: 10558
Uniprot ID: O15269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
• Gene Sequence: GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
• Gene ID - Mouse: ENSMUSG00000021468
• Gene ID - Rat: ENSRNOG00000010882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.