Anti SPTBN5 pAb (ATL-HPA055283)

Atlas Antibodies

SKU:
ATL-HPA055283-25
  • Immunohistochemical staining of human retina shows strong cytoplasmic and nuclear positivity in photoreceptor and inner nuclear layers.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: spectrin beta, non-erythrocytic 5
Gene Name: SPTBN5
Alternative Gene Name: BSPECV, HUBSPECV, HUSPECV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021061: 32%, ENSRNOG00000006911: 32%
Entrez Gene ID: 51332
Uniprot ID: Q9NRC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKVASIALLDLTGARCERLRGRHGRKHTFSLRLTSGAEILFAAPSEEQAESWWRALGSTAAQSLSPKLKAKPVSSL
Gene Sequence EKVASIALLDLTGARCERLRGRHGRKHTFSLRLTSGAEILFAAPSEEQAESWWRALGSTAAQSLSPKLKAKPVSSL
Gene ID - Mouse ENSMUSG00000021061
Gene ID - Rat ENSRNOG00000006911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPTBN5 pAb (ATL-HPA055283)
Datasheet Anti SPTBN5 pAb (ATL-HPA055283) Datasheet (External Link)
Vendor Page Anti SPTBN5 pAb (ATL-HPA055283) at Atlas Antibodies

Documents & Links for Anti SPTBN5 pAb (ATL-HPA055283)
Datasheet Anti SPTBN5 pAb (ATL-HPA055283) Datasheet (External Link)
Vendor Page Anti SPTBN5 pAb (ATL-HPA055283)