Anti SPTA1 pAb (ATL-HPA028253)

Atlas Antibodies

Catalog No.:
ATL-HPA028253-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: spectrin, alpha, erythrocytic 1
Gene Name: SPTA1
Alternative Gene Name: EL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026532: 67%, ENSRNOG00000003537: 69%
Entrez Gene ID: 6708
Uniprot ID: P02549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECA
Gene Sequence MEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECA
Gene ID - Mouse ENSMUSG00000026532
Gene ID - Rat ENSRNOG00000003537
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPTA1 pAb (ATL-HPA028253)
Datasheet Anti SPTA1 pAb (ATL-HPA028253) Datasheet (External Link)
Vendor Page Anti SPTA1 pAb (ATL-HPA028253) at Atlas Antibodies

Documents & Links for Anti SPTA1 pAb (ATL-HPA028253)
Datasheet Anti SPTA1 pAb (ATL-HPA028253) Datasheet (External Link)
Vendor Page Anti SPTA1 pAb (ATL-HPA028253)