Anti SPSB4 pAb (ATL-HPA062793)

Atlas Antibodies

Catalog No.: ATL-HPA062793-25

Protein Description: splA/ryanodine receptor domain and SOCS box containing 4
Gene Name: SPSB4
Alternative Gene Name: SSB-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046997: 98%, ENSRNOG00000012862: 98%
Entrez Gene ID: 92369
Uniprot ID: Q96A44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH
• Gene Sequence: QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH
• Gene ID - Mouse: ENSMUSG00000046997
• Gene ID - Rat: ENSRNOG00000012862
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.