Anti SPSB4 pAb (ATL-HPA062793)

Atlas Antibodies

Catalog No.:
ATL-HPA062793-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: splA/ryanodine receptor domain and SOCS box containing 4
Gene Name: SPSB4
Alternative Gene Name: SSB-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046997: 98%, ENSRNOG00000012862: 98%
Entrez Gene ID: 92369
Uniprot ID: Q96A44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH
Gene Sequence QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH
Gene ID - Mouse ENSMUSG00000046997
Gene ID - Rat ENSRNOG00000012862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPSB4 pAb (ATL-HPA062793)
Datasheet Anti SPSB4 pAb (ATL-HPA062793) Datasheet (External Link)
Vendor Page Anti SPSB4 pAb (ATL-HPA062793) at Atlas Antibodies

Documents & Links for Anti SPSB4 pAb (ATL-HPA062793)
Datasheet Anti SPSB4 pAb (ATL-HPA062793) Datasheet (External Link)
Vendor Page Anti SPSB4 pAb (ATL-HPA062793)