Anti SPSB2 pAb (ATL-HPA055225)

Atlas Antibodies

Catalog No.: ATL-HPA055225-25

Protein Description: splA/ryanodine receptor domain and SOCS box containing 2
Gene Name: SPSB2
Alternative Gene Name: GRCC9, SSB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038451: 87%, ENSRNOG00000047113: 87%
Entrez Gene ID: 84727
Uniprot ID: Q99619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
• Gene Sequence: MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
• Gene ID - Mouse: ENSMUSG00000038451
• Gene ID - Rat: ENSRNOG00000047113
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.