Anti SPSB2 pAb (ATL-HPA055225)

Atlas Antibodies

Catalog No.:
ATL-HPA055225-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: splA/ryanodine receptor domain and SOCS box containing 2
Gene Name: SPSB2
Alternative Gene Name: GRCC9, SSB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038451: 87%, ENSRNOG00000047113: 87%
Entrez Gene ID: 84727
Uniprot ID: Q99619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
Gene Sequence MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
Gene ID - Mouse ENSMUSG00000038451
Gene ID - Rat ENSRNOG00000047113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPSB2 pAb (ATL-HPA055225)
Datasheet Anti SPSB2 pAb (ATL-HPA055225) Datasheet (External Link)
Vendor Page Anti SPSB2 pAb (ATL-HPA055225) at Atlas Antibodies

Documents & Links for Anti SPSB2 pAb (ATL-HPA055225)
Datasheet Anti SPSB2 pAb (ATL-HPA055225) Datasheet (External Link)
Vendor Page Anti SPSB2 pAb (ATL-HPA055225)