Anti SPRY4 pAb (ATL-HPA072661)

Atlas Antibodies

SKU:
ATL-HPA072661-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sprouty RTK signaling antagonist 4
Gene Name: SPRY4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024427: 91%, ENSRNOG00000013851: 91%
Entrez Gene ID: 81848
Uniprot ID: Q9C004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACG
Gene Sequence SSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACG
Gene ID - Mouse ENSMUSG00000024427
Gene ID - Rat ENSRNOG00000013851
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPRY4 pAb (ATL-HPA072661)
Datasheet Anti SPRY4 pAb (ATL-HPA072661) Datasheet (External Link)
Vendor Page Anti SPRY4 pAb (ATL-HPA072661) at Atlas Antibodies

Documents & Links for Anti SPRY4 pAb (ATL-HPA072661)
Datasheet Anti SPRY4 pAb (ATL-HPA072661) Datasheet (External Link)
Vendor Page Anti SPRY4 pAb (ATL-HPA072661)