Anti SPRY4 pAb (ATL-HPA055471)

Atlas Antibodies

Catalog No.:
ATL-HPA055471-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sprouty RTK signaling antagonist 4
Gene Name: SPRY4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024427: 57%, ENSRNOG00000013851: 61%
Entrez Gene ID: 81848
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEACFSVQSRTSSPMEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLT
Gene Sequence LEACFSVQSRTSSPMEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLT
Gene ID - Mouse ENSMUSG00000024427
Gene ID - Rat ENSRNOG00000013851
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPRY4 pAb (ATL-HPA055471)
Datasheet Anti SPRY4 pAb (ATL-HPA055471) Datasheet (External Link)
Vendor Page Anti SPRY4 pAb (ATL-HPA055471) at Atlas Antibodies

Documents & Links for Anti SPRY4 pAb (ATL-HPA055471)
Datasheet Anti SPRY4 pAb (ATL-HPA055471) Datasheet (External Link)
Vendor Page Anti SPRY4 pAb (ATL-HPA055471)