Anti SPRY1 pAb (ATL-HPA051369)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051369-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SPRY1
Alternative Gene Name: hSPRY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037211: 77%, ENSRNOG00000025371: 74%
Entrez Gene ID: 10252
Uniprot ID: O43609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP |
| Gene Sequence | PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP |
| Gene ID - Mouse | ENSMUSG00000037211 |
| Gene ID - Rat | ENSRNOG00000025371 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPRY1 pAb (ATL-HPA051369) | |
| Datasheet | Anti SPRY1 pAb (ATL-HPA051369) Datasheet (External Link) |
| Vendor Page | Anti SPRY1 pAb (ATL-HPA051369) at Atlas Antibodies |
| Documents & Links for Anti SPRY1 pAb (ATL-HPA051369) | |
| Datasheet | Anti SPRY1 pAb (ATL-HPA051369) Datasheet (External Link) |
| Vendor Page | Anti SPRY1 pAb (ATL-HPA051369) |
| Citations for Anti SPRY1 pAb (ATL-HPA051369) – 1 Found |
| Chai, Chang; Song, Lai-Jun; Han, Shuang-Yin; Li, Xi-Qing; Li, Ming. MicroRNA-21 promotes glioma cell proliferation and inhibits senescence and apoptosis by targeting SPRY1 via the PTEN/PI3K/AKT signaling pathway. Cns Neuroscience & Therapeutics. 2018;24(5):369-380. PubMed |