Anti SPRY1 pAb (ATL-HPA051369)

Atlas Antibodies

Catalog No.:
ATL-HPA051369-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sprouty homolog 1, antagonist of FGF signaling (Drosophila)
Gene Name: SPRY1
Alternative Gene Name: hSPRY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037211: 77%, ENSRNOG00000025371: 74%
Entrez Gene ID: 10252
Uniprot ID: O43609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
Gene Sequence PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
Gene ID - Mouse ENSMUSG00000037211
Gene ID - Rat ENSRNOG00000025371
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPRY1 pAb (ATL-HPA051369)
Datasheet Anti SPRY1 pAb (ATL-HPA051369) Datasheet (External Link)
Vendor Page Anti SPRY1 pAb (ATL-HPA051369) at Atlas Antibodies

Documents & Links for Anti SPRY1 pAb (ATL-HPA051369)
Datasheet Anti SPRY1 pAb (ATL-HPA051369) Datasheet (External Link)
Vendor Page Anti SPRY1 pAb (ATL-HPA051369)
Citations for Anti SPRY1 pAb (ATL-HPA051369) – 1 Found
Chai, Chang; Song, Lai-Jun; Han, Shuang-Yin; Li, Xi-Qing; Li, Ming. MicroRNA-21 promotes glioma cell proliferation and inhibits senescence and apoptosis by targeting SPRY1 via the PTEN/PI3K/AKT signaling pathway. Cns Neuroscience & Therapeutics. 2018;24(5):369-380.  PubMed