Anti SPRTN pAb (ATL-HPA025073)

Atlas Antibodies

Catalog No.: ATL-HPA025073-25

Protein Description: SprT-like N-terminal domain
Gene Name: SPRTN
Alternative Gene Name: C1orf124, DKFZP547N043, DVC1, Spartan
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031986: 54%, ENSRNOG00000021330: 55%
Entrez Gene ID: 83932
Uniprot ID: Q9H040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT
• Gene Sequence: SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT
• Gene ID - Mouse: ENSMUSG00000031986
• Gene ID - Rat: ENSRNOG00000021330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPRTN pAb (ATL-HPA025073) – 4 Found

Mosbech, Anna; Gibbs-Seymour, Ian; Kagias, Konstantinos; Thorslund, Tina; Beli, Petra; Povlsen, Lou; Nielsen, Sofie Vincents; Smedegaard, Stine; Sedgwick, Garry; Lukas, Claudia; Hartmann-Petersen, Rasmus; Lukas, Jiri; Choudhary, Chunaram; Pocock, Roger; Bekker-Jensen, Simon; Mailand, Niels. DVC1 (C1orf124) is a DNA damage-targeting p97 adaptor that promotes ubiquitin-dependent responses to replication blocks. Nature Structural & Molecular Biology. 2012;19(11):1084-92. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Lopez-Mosqueda, Jaime; Maddi, Karthik; Prgomet, Stefan; Kalayil, Sissy; Marinovic-Terzic, Ivana; Terzic, Janos; Dikic, Ivan. SPRTN is a mammalian DNA-binding metalloprotease that resolves DNA-protein crosslinks. Elife. 2016;5( 27852435) 

Na, Juri; Newman, Joseph A; Then, Chee Kin; Syed, Junetha; Vendrell, Iolanda; Torrecilla, Ignacio; Ellermann, Sophie; Ramadan, Kristijan; Fischer, Roman; Kiltie, Anne E. SPRTN protease-cleaved MRE11 decreases DNA repair and radiosensitises cancer cells. Cell Death & Disease. 2021;12(2):165.