Anti SPRED1 pAb (ATL-HPA061805)

Atlas Antibodies

SKU: ATL-HPA061805-25

• 
• 

Protein Description: sprouty-related, EVH1 domain containing 1
Gene Name: SPRED1
Alternative Gene Name: FLJ33903, PPP1R147
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027351: 98%, ENSRNOG00000005209: 92%
Entrez Gene ID: 161742
Uniprot ID: Q7Z699
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTP
• Gene Sequence: GGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTP
• Gene ID - Mouse: ENSMUSG00000027351
• Gene ID - Rat: ENSRNOG00000005209
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.