Anti SPPL3 pAb (ATL-HPA059958)

Atlas Antibodies

Catalog No.: ATL-HPA059958-25

Protein Description: signal peptide peptidase like 3
Gene Name: SPPL3
Alternative Gene Name: DKFZP586C1324, IMP2, MGC126674, MGC126676, MGC90402, PSL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029550: 100%, ENSRNOG00000001178: 97%
Entrez Gene ID: 121665
Uniprot ID: Q8TCT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLRYDNYKKQASGDSCGAPGPANISGRMQKVSY
• Gene Sequence: VLRYDNYKKQASGDSCGAPGPANISGRMQKVSY
• Gene ID - Mouse: ENSMUSG00000029550
• Gene ID - Rat: ENSRNOG00000001178
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.