Anti SPPL2B pAb (ATL-HPA039292)

Atlas Antibodies

Catalog No.:
ATL-HPA039292-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: signal peptide peptidase like 2B
Gene Name: SPPL2B
Alternative Gene Name: IMP4, KIAA1532, PSL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035206: 97%, ENSRNOG00000057881: 90%
Entrez Gene ID: 56928
Uniprot ID: Q8TCT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV
Gene Sequence YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV
Gene ID - Mouse ENSMUSG00000035206
Gene ID - Rat ENSRNOG00000057881
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPPL2B pAb (ATL-HPA039292)
Datasheet Anti SPPL2B pAb (ATL-HPA039292) Datasheet (External Link)
Vendor Page Anti SPPL2B pAb (ATL-HPA039292) at Atlas Antibodies

Documents & Links for Anti SPPL2B pAb (ATL-HPA039292)
Datasheet Anti SPPL2B pAb (ATL-HPA039292) Datasheet (External Link)
Vendor Page Anti SPPL2B pAb (ATL-HPA039292)