Anti SPOUT1 pAb (ATL-HPA076946)

Atlas Antibodies

SKU:
ATL-HPA076946-25
  • Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SPOUT domain containing methyltransferase 1
Gene Name: SPOUT1
Alternative Gene Name: C9orf114, CENP-32, HSPC109
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039660: 85%, ENSRNOG00000025711: 85%
Entrez Gene ID: 51490
Uniprot ID: Q5T280
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLS
Gene Sequence CGPGEHGQRIEWRKWKQQKKEEKKKWKDLKLMKKLERQRAQEEQAKRLEEEEAAAEKEDRGRPYTLS
Gene ID - Mouse ENSMUSG00000039660
Gene ID - Rat ENSRNOG00000025711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SPOUT1 pAb (ATL-HPA076946)
Datasheet Anti SPOUT1 pAb (ATL-HPA076946) Datasheet (External Link)
Vendor Page Anti SPOUT1 pAb (ATL-HPA076946) at Atlas Antibodies

Documents & Links for Anti SPOUT1 pAb (ATL-HPA076946)
Datasheet Anti SPOUT1 pAb (ATL-HPA076946) Datasheet (External Link)
Vendor Page Anti SPOUT1 pAb (ATL-HPA076946)