Anti SPON1 pAb (ATL-HPA077546)

Atlas Antibodies

Catalog No.:
ATL-HPA077546-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: spondin 1
Gene Name: SPON1
Alternative Gene Name: f-spondin, KIAA0762
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038156: 97%, ENSRNOG00000058003: 97%
Entrez Gene ID: 10418
Uniprot ID: Q9HCB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPV
Gene Sequence SLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPV
Gene ID - Mouse ENSMUSG00000038156
Gene ID - Rat ENSRNOG00000058003
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPON1 pAb (ATL-HPA077546)
Datasheet Anti SPON1 pAb (ATL-HPA077546) Datasheet (External Link)
Vendor Page Anti SPON1 pAb (ATL-HPA077546) at Atlas Antibodies

Documents & Links for Anti SPON1 pAb (ATL-HPA077546)
Datasheet Anti SPON1 pAb (ATL-HPA077546) Datasheet (External Link)
Vendor Page Anti SPON1 pAb (ATL-HPA077546)