Anti SPOCK1 pAb (ATL-HPA007450)

Atlas Antibodies

Catalog No.: ATL-HPA007450-25

Protein Description: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1
Gene Name: SPOCK1
Alternative Gene Name: SPOCK, testican-1, TIC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056222: 98%, ENSRNOG00000012747: 99%
Entrez Gene ID: 6695
Uniprot ID: Q08629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGG
• Gene Sequence: FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGG
• Gene ID - Mouse: ENSMUSG00000056222
• Gene ID - Rat: ENSRNOG00000012747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPOCK1 pAb (ATL-HPA007450) – 3 Found

Damhofer, Helene; Medema, Jan Paul; Veenstra, Veronique L; Badea, Liviu; Popescu, Irinel; Roelink, Henk; Bijlsma, Maarten F. Assessment of the stromal contribution to Sonic Hedgehog-dependent pancreatic adenocarcinoma. Molecular Oncology. 2013;7(6):1031-42. 

Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933. 

Lin, Yung-Wei; Wen, Yu-Ching; Hsiao, Chi-Hao; Lai, Feng-Ru; Yang, Shun-Fa; Yang, Yi-Chieh; Ho, Kuo-Hao; Hsieh, Feng-Koo; Hsiao, Michael; Lee, Wei-Jiunn; Chien, Ming-Hsien. Proteoglycan SPOCK1 as a Poor Prognostic Marker Promotes Malignant Progression of Clear Cell Renal Cell Carcinoma via Triggering the Snail/Slug-MMP-2 Axis-Mediated Epithelial-to-Mesenchymal Transition. Cells. 2023;12(3)