Anti SPINT3 pAb (ATL-HPA026852 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026852-25

Protein Description: serine peptidase inhibitor, Kunitz type 3
Gene Name: SPINT3
Alternative Gene Name: HKIB9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074595: 44%, ENSRNOG00000052294: 42%
Entrez Gene ID: 10816
Uniprot ID: P49223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT
• Gene Sequence: DTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT
• Gene ID - Mouse: ENSMUSG00000074595
• Gene ID - Rat: ENSRNOG00000052294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.