Anti SPINK6 pAb (ATL-HPA011039)

Atlas Antibodies

Catalog No.: ATL-HPA011039-25

Protein Description: serine peptidase inhibitor, Kazal type 6
Gene Name: SPINK6
Alternative Gene Name: BUSI2, MGC21394, UNQ844
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055095: 78%, ENSRNOG00000048570: 78%
Entrez Gene ID: 404203
Uniprot ID: Q6UWN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKH
• Gene Sequence: VDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKH
• Gene ID - Mouse: ENSMUSG00000055095
• Gene ID - Rat: ENSRNOG00000048570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.