Anti SPINK4 pAb (ATL-HPA007286 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007286-25

Protein Description: serine peptidase inhibitor, Kazal type 4
Gene Name: SPINK4
Alternative Gene Name: MGC133107, PEC-60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028415: 70%, ENSRNOG00000008252: 65%
Entrez Gene ID: 27290
Uniprot ID: O60575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGK
• Gene Sequence: LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGK
• Gene ID - Mouse: ENSMUSG00000028415
• Gene ID - Rat: ENSRNOG00000008252
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPINK4 pAb (ATL-HPA007286 w/enhanced validation) – 1 Found

Owen, Richard Peter; White, Michael Joseph; Severson, David Tyler; Braden, Barbara; Bailey, Adam; Goldin, Robert; Wang, Lai Mun; Ruiz-Puig, Carlos; Maynard, Nicholas David; Green, Angie; Piazza, Paolo; Buck, David; Middleton, Mark Ross; Ponting, Chris Paul; Schuster-Böckler, Benjamin; Lu, Xin. Single cell RNA-seq reveals profound transcriptional similarity between Barrett's oesophagus and oesophageal submucosal glands. Nature Communications. 2018;9(1):4261.